SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120064 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000120064
Domain Number - Region: 76-108
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.00157
Family Translation initiation factor IF3, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120064   Gene: ENSMUSG00000016510   Transcript: ENSMUST00000140526
Sequence length 109
Comment pep:known chromosome:GRCm38:5:146958948:146963800:-1 gene:ENSMUSG00000016510 transcript:ENSMUST00000140526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLLMRLMLQTTKLDHNLIGRCLQRHAVKPDPAQLSLSASTPKLLYLTSAKGFSTAGDP
QGERKQKRRDAFSNTGRKISERIIRVLDEKGMDLGMMHRADVIRLMNKQ
Download sequence
Identical sequences D3YWL2
ENSMUSP00000120064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]