SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126909 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126909
Domain Number 1 Region: 251-343
Classification Level Classification E-value
Superfamily TAFH domain-like 2.88e-32
Family TAFH domain-like 0.0000366
Further Details:      
 
Domain Number 2 Region: 648-696
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000157
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126909   Gene: ENSMUSG00000054321   Transcript: ENSMUST00000169862
Sequence length 855
Comment pep:known chromosome:GRCm38:18:14783245:14900359:1 gene:ENSMUSG00000054321 transcript:ENSMUST00000169862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGLTEPAGAAAPVVSSASGAVTMAPVAALPVRVEGTPVALGPVTKAPVSVCVESVAPQ
PLPAPVGTLVTKVVPVTALPKLGSPRLPAPQIVTVKTPGTTTIQLPANLQLPPGTVLIKS
NSGQLMLVSPQQAVTGAKTTSNITPRPAVPANTQTVKICTVPNSSSQLMKKVTVAPVKNL
TQIGTTVATTASSTSSGQPVALPSSVITVTPAKLVNTVSTLKSSSLGVLSTPSNDARLKA
ETSVAAQTALPPTVLENVKKCKNFLSMLIKLACSGSQSPEMGQNVKRLVEQLLDAEIEAE
EFTRKLYIELKSAPQPHLVPFLKKSVVALRQLLPNSQSFIENCVKEVSGDVVISSCTMTT
ATSPVVTSTVSPVLVSGATAPRTLSVQQTLNPLAGPGVANTGVVTLHSVAPAAATGGTTA
ATVLLQTSKPLTTSVPNTVAAVSLQPENPVVSGAAVTLAIPSATFGEASATPLCLPSAKP
AITSAGTKADKPAIGTPVQIVTQPSTLLPQAAGIPQTAKVKQLVVQQPSGSSVNHVTSIS
HSSPLSTQNCGQKTPVNAVMPTSKFPPSSIIKQITLPGNKLLSLQAQRSSIQSNKIKENG
PTCFRGEDDINDVTFMAEVNLDEENACILAAHSDFVGTLIQSCKEEPFLVIGALQKRILD
IGKKHDITELNSDAVNLISHATQERLRGLLEKLTTIAQHRMTIYKGSENYILSTDTRSQL
KFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQIQYRDA
NLTALAAIGPRKKRPLESGNESFKDNPSTSGTSSLTATKPFRPRITRICLRDLIFCMEQE
REMKYSRALYLALLK
Download sequence
Identical sequences G5E8Z2
NP_001093919.1.92730 ENSMUSP00000126909 ENSMUSP00000126909 ENSMUSP00000126909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]