SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126917 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126917
Domain Number 1 Region: 51-501
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.35e-97
Family L-arabinose binding protein-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126917   Gene: ENSMUSG00000090774   Transcript: ENSMUST00000166355
Sequence length 853
Comment pep:novel chromosome:GRCm38:7:85951867:85961482:-1 gene:ENSMUSG00000090774 transcript:ENSMUST00000166355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFLNSVFWLLKISFNFGHLSDPRCFWRIKDTENKLGDKETYCFFTISTKHGYVKNDYFR
WNLDKKVTPKTRHLIFSVYLALEEINKNCHILPNISLVVNIECVLDKHDEKTDFLFKSED
LIPNYYCKNERRYLIVLTAPLWAVSSSIGPYLFMSRIPEVSQLYCGHFHLPLSDNEQYPH
LHQISRKDTFLPLAMVSLVVHFRWNWIGVIVTNDDHGIQFLSEFRGEMQNKIVCLSFAII
IKTGKFLAVTELHMNYKQILMSSAKVVIVYGYRDSPIIYAFIVWKSQDLFRIWVSVSQLD
MITFLGDFLLYASTGTFIFSHQKPEISGFEQFIQRIHPSNYSSEFSLAKQWWTYFRCSLP
PSNCKKLKNCSTKTVFKWLFMTPLGLAMSDTCYNIYNAMYAVAHSLHGMLLQQVDTWSKN
AGKELEFDSWKMFSILKTLKFVNPAGDLVNMNQNLKQDVEFDVFYIMDFQKDYGLKMKIG
RFSEHLPSGQQIYMSKEMIEWATDIDQILPSICTMPCRPGLRKSPQEGKDICCFDCKPCS
ENEVSNMTNMDQCVKCPEDQYANEDHTVCLQKVVTILDYRDPLGKALAGFALCFSVLTSL
VLVVFLKHRDTPIVKANNQTLSFVLLISLIFCFICSLLYIGHPTMAICILQQTTFAIVFT
VATSTILSKTVIVILAFKITVPGRRMRWLLESGTPKYIIPICTIIQLILCGIWLGTSPPF
VDADLHMVHGHILIVCNKGSVIAFYCVLGYMGSVALASFTVAFLARNLPDTFNEAKLLTF
SMLVFCSVWITFIPVYHSTKGKTMVAVEVFCILASSAGLLLCIFAPKCYIILLRPQKNYF
YKFRKRRELNLTT
Download sequence
Identical sequences E9PW21
ENSMUSP00000126917 ENSMUSP00000126917 ENSMUSP00000126917 NP_001098657.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]