SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127652 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127652
Domain Number 1 Region: 33-120
Classification Level Classification E-value
Superfamily ALDH-like 0.00000000000275
Family ALDH-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127652   Gene: ENSMUSG00000053644   Transcript: ENSMUST00000171844
Sequence length 121
Comment pep:novel chromosome:GRCm38:18:56550367:56562197:-1 gene:ENSMUSG00000053644 transcript:ENSMUST00000171844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQSVKTSKLSGPWSRPAAHMSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEASLKD
YEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLVSLEMGKILVEGIGEV
Q
Download sequence
Identical sequences E9Q1G1
ENSMUSP00000127652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]