SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128642 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128642
Domain Number 1 Region: 27-138
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 3.27e-37
Family Substrate-binding domain of HMG-CoA reductase 0.00000266
Further Details:      
 
Domain Number 2 Region: 2-33
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 0.00000000136
Family NAD-binding domain of HMG-CoA reductase 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128642   Gene: ENSMUSG00000021670   Transcript: ENSMUST00000169945
Sequence length 165
Comment pep:putative chromosome:GRCm38:13:96650443:96652803:-1 gene:ENSMUSG00000021670 transcript:ENSMUST00000169945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XQEFFPDMQILAVSGNYCTDKKPAAINWIEGRGKTVVCEAVIPAKVVREVLKTTTEAMVD
VNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQMLGVQGACKDNPGENARQLARIVC
GTVMAGELSLMAALAAGHLVRSHMVHNRSKINLQDLQGTCTKKAA
Download sequence
Identical sequences F7CA39
ENSMUSP00000128642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]