SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128818 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128818
Domain Number 1 Region: 668-764
Classification Level Classification E-value
Superfamily Fibronectin type III 5.59e-18
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 111-213
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000127
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128818   Gene: ENSMUSG00000035258   Transcript: ENSMUST00000171000
Sequence length 909
Comment pep:known chromosome:GRCm38:16:56477846:56690128:1 gene:ENSMUSG00000035258 transcript:ENSMUST00000171000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSLGCLLLCGSIALALGNAQKLPKGKKPSLKVHINTTSDSILLKFLRPNANVKLEGFL
LGYGSNVSPNQYFPLPTEGKFTEAVVDAEPKYLIVVRPAPPPSQKKSCSGKSRPRKPLQL
VVGTLTPSSVFLSWGFLINPHHDWTLPSHCPSDRFYTIRYREKDKEKKWIFQLCPATETI
VENLKPNTVYEFGVKDNIEGGIWSKIFNHKTIVGSKNKVNGKIQSTYDQVHSVPVPRKLI
PLTIIKQVIQNVTHRASTKSPDKTPFGGTILVHLIIPGLNESTVKLPTSIMLEISDALKA
QLAKNETLALPAESKTPEVEKLAGQPVTVTPESVSRSTKPTLSSALDTAETALAPRQTTS
MPPKLKTPHSRMPAKEPVPKEPLHTTSKPKMPPSPEVADTTSAPLETRGIPLIPVISPRP
SQEELQTAMEETDQSTQELFTTKIPRTTELAKTTQAPHRLHTAPVRPRIPGRPHGRPALN
KTTTRPDKTKPRGTSHKNGVGTGTKQAPKPPSPGRNASVDSHATRKPGSVSGTRRPPIPH
RHSSTRPVSPERRPLPPNNVTGKPGRAGIVSSSRVTSPPLKATLHPIGTATARPGAEQKE
PTAPASEEEFGTTTDFSSSPTKETDPLGKPRFIGPHVRYIPKPENKPCSITDSVRRFPTE
EATEGNATSPPQNPPTNLTVVTVEGCPSFVILDWEKPLNDTVTEYEVISRENGSFSGKNK
SIQITNQTFSTVENLKPDTSYEFQVKPKNPLGEGPASNTVAFSTESADPRVSEPISAGRD
AIWTERPFNSDSYSECKGKQYVKRTWYKKFVGVQLCNSLRYKIYLSDSLTGKFYNIGDQR
GHGEDHCQFVDSFLDGRTGQQLTSEQLPTKEGYFRAVRQEPVQFGEIGGHTQINYVQWYE
CGTTIPGKW
Download sequence
Identical sequences E9Q8E3
NP_001014421.2.92730 ENSMUSP00000128818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]