SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129145 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129145
Domain Number 1 Region: 31-509
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.67e-91
Family L-arabinose binding protein-like 0.00073
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000129145
Domain Number - Region: 520-580
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00989
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129145   Gene: ENSMUSG00000094145   Transcript: ENSMUST00000172199
Sequence length 853
Comment pep:known chromosome:GRCm38:6:123385262:123418061:-1 gene:ENSMUSG00000094145 transcript:ENSMUST00000172199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLIAFSLWIVLIVLQEQISCYLLSISASPGYYQDGDFVIGGLLSLKVSGRHNKNKFTS
GNEYNLPEYVYIDFTKHYQHILAMVFAIEKINKDPNILFNMSLGFHVFNVDFTEMKAMKS
SMVLLSGESPPVPNYSCRPEKTDKLVAVIGGISTGISTQISRVLSLYNVPQISYAPFDQS
LGTIVQLQSPYQFPVHTAALYQGIIQLLLYFTWVWVGLVVPDDIRGELFLRDITEEMMNH
GLCVAFAEKIQGILAEDKVNTKLFNEKFTLTRVIIAFGDTYSLLALAVHTTFYTTFRNVW
ITTSDWDITFYFQQPKSYEYFGGGLSFTDRMDQILGFKDFLRNVQPRKYPQDIFIQDVWM
VLFECPYLIDHEARQLSQCEPNGSLSTRPLHVWDMNTSPCSSKVHAAVYAIAQALHEELS
LRVEGGSLDKSVLRAPLPWKLHPFLQKGQLGRSSNKENIVNKEILATEFDIFNYQSLQSG
TKAQVKVGEFVFESHSVQHFSLNEKLITWGKYGKEIPLSVCSQSCPLGFRKTPVEGKSFC
CFDCLPCPEGEIANETDMDQCIKCPEDQYPNKQKNNCLPKIKIFLSHEDTLGAVLVSLAI
SLSAFSAMILGLFIHYRDTPIVRANNRNLSYVLLVSLMLCFFCSLIFIGQPSTVTCVLRQ
MIFGVVFSVAVSAILAKTFIVVVAFTAIKPGSTLQMWMVTRLSNAIVCCGSIIQVCICAV
WLGTSPPFPDVDMHSEFGQIILWCNEGSTLAFYCVLGYLGFLSSLSLLIAFLARRLPESF
NEAKTITFSMLVFCTVWITFVPTYLSSKGKTMVAVEILSILASSSILLLCIFLPKCYVIL
LRSGGHSRKKFFK
Download sequence
Identical sequences L7N2B1
PGOMOU00000137309 ENSMUSP00000129145 ENSMUSP00000129145 ENSMUSP00000129145 NP_001098104.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]