SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129782 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129782
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.69e-93
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-33
Family Spectrin repeat 0.0000908
Further Details:      
 
Domain Number 3 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 8.88e-30
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 1532-1687
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-29
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 1009-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-29
Family Spectrin repeat 0.00000428
Further Details:      
 
Domain Number 6 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 5.64e-29
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 7 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-27
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 8 Region: 1229-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 3.82e-24
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 9 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 3.88e-23
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 10 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 11 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 2.56e-19
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 12 Region: 529-636
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-18
Family Spectrin repeat 0.00066
Further Details:      
 
Domain Number 13 Region: 1347-1447
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000183
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 14 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000158
Family Spectrin repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000129782
Domain Number - Region: 1170-1244
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0762
Family Spectrin repeat 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129782   Gene: ENSMUSG00000021061   Transcript: ENSMUST00000166101
Sequence length 2137
Comment pep:novel chromosome:GRCm38:12:76596130:76710023:-1 gene:ENSMUSG00000021061 transcript:ENSMUST00000166101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSATEFENVGNQPPFSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRISDLYKDLRDGRMLIKLLEVLSGEMLPRPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTISVLNSRKFANSLSGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRSELIRQEKL
EQLARRFDRKAAMRETWLNENQRLVTQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVKA
LEDLAQELEKENYHDQKRIIARKDNILRLWSYLQELLRSRRQRLEATLALQKLFQDMLHS
IDWMDEIKAHILSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLQFAEGKGY
QPCDPQVIQDRVSHLEQCFSELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLKQIFQEADDMVAQKQFGHPQIETRVKE
VSAQWDHLKELAAFRKKDLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRA
LGKKHKEFLEELEESRGVMEHLEHQAQGFPEEFRDSPDVTNRLQALRKLYQQVLTQAELR
GHKLQEALDLYTVFGESDACELWMTEKGKWLDQMDIPNTLEDLEVVQHRFDILDQEMKTL
MAQIDGVNLAANNLVESGHPRSGEVKQYQDRLNKRWQAFQAVVSEQREAVDSALRVNNYC
VDCEETSKWIMDKTKVVESTKDLGQDLAGVIAIQRKLSGLERDVLAIRDRVSALERESQY
LMESHPEQKEDIGQRQADVEKLWKGLQDALQGQELSLGEASKLQAFLQDLDDFKAWLSMA
QKAVASEDMPESLPEAEQLLQQHAAIKEEIDAHRDDYHRVKASGEKVIEGQTDPDYQLLG
QRLEGLDTDWDALRRMWESRGNTLTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
AAAEAGIRKFEDFLVSMENNRDKILSPVDSGNKLVAEGNLYSNKIMEKVQLIEDRHKKNN
EKAQEATVLLKDNLELQNFLQNCKELTLWINDKLLTSPDVSYDEARNLHNKWMKHQAFMA
ELASHQGWLENIDAEGRQLMAEKPQFKDVVSERLEALHKLWEELQSTAKAKAEQLSAARS
SDLRLQTHADLNKWIGAMEDQLRSDDLGKDLTTVNRMLAKLKALEEQVNLRKEELEELFA
DAPSLGAEAGDTDMSIEKRFLDLLEPLGRRKKQLELSKAKLQISRDLEDETLWVEERLPL
AQSADYGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLRRGQELVKAAEIDCQDIEERLG
HLQSSWDTLREAAAGRLQRLRDAHEAQQYYLDAGEAEAWISEQELYVFSDEPPKDEEGAI
VMLKRHLRQQRTVEEYGRNIKQLAGRAQSLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAE
ERRRRLENMYHLFQLKREADDLEQWITEKEMVASSQEMGQDFDHVTMLRDKFRDFARETG
AIGQERVDNVNTIIERLIDAGHSEAATIAEWKDGLNDMWADLLELIDTRMQLLAASYDLH
RYFYTGTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVAT
RLQTAYAGEKADAIQSKEQEVSAAWQALLDACAGRRAQLVDTADKFRFFSMVRDLLSWME
SIIRQIETQERPRDVSSVELLLKYHQGIKAEINTRAKNFSTCLELGESLLQRQHQASDEI
REKLQQVISRRQEMNDKWEARSDRLHMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHT
VDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQTPERPTEEPGPQEEEGETAG
EAPQVHHAATERTSPVSFMSRLSSSWESLLPEPAHPF
Download sequence
Identical sequences E9Q397
ENSMUSP00000129782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]