SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131920 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131920
Domain Number 1 Region: 1-183
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.01e-38
Family ADP-ribosylglycohydrolase 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131920   Gene: ENSMUSG00000031448   Transcript: ENSMUST00000168498
Sequence length 205
Comment pep:putative chromosome:GRCm38:8:13242510:13254071:-1 gene:ENSMUSG00000031448 transcript:ENSMUST00000168498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFKAAMLLGSVGDALGYGNICRENSVLGSIQEELQKTGGLDSLVLSPGRWPVSDNTIM
HMATAEALTTGSGFGAATKAMCIGMRYWKPERLETLIEVSIECGRMTHNHPTGFLGSLCT
ALFASYALQGKPLVQWGREMLKVLPLAEEYCRKTIRHMAEYQEHWFYFEAKWQFYLEERK
IREDAEDKVTFPDNYDAEERDKVSP
Download sequence
Identical sequences E9Q4C0
ENSMUSP00000131920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]