SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133359 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133359
Domain Number 1 Region: 33-172
Classification Level Classification E-value
Superfamily Apolipoprotein 4.58e-43
Family Apolipoprotein 0.000000747
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133359   Gene: ENSMUSG00000002985   Transcript: ENSMUST00000172983
Sequence length 232
Comment pep:known chromosome:GRCm38:7:19696620:19699038:-1 gene:ENSMUSG00000002985 transcript:ENSMUST00000172983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALWAVLLVTLLTGCLAEGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEE
LQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMED
LRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGA
ERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVG
Download sequence
Identical sequences G3UWN5
ENSMUSP00000133359 ENSMUSP00000134622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]