SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000135817 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000135817
Domain Number 1 Region: 3-60
Classification Level Classification E-value
Superfamily POZ domain 2.35e-16
Family BTB/POZ domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000135817   Gene: ENSMUSG00000056459   Transcript: ENSMUST00000176509
Sequence length 67
Comment pep:putative chromosome:GRCm38:12:76348944:76368999:-1 gene:ENSMUSG00000056459 transcript:ENSMUST00000176509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTASHSLVLLQQLNMQREFGFLCDCTVAIGDVYFKAHRAVLAAFSNYFKMIFIHQTRKR
AKTDCGS
Download sequence
Identical sequences H3BLJ8
ENSMUSP00000135817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]