SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136943 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000136943
Domain Number 1 Region: 316-367
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.88e-19
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 2 Region: 7-50
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000523
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00026
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000136943
Domain Number - Region: 177-212,254-321
Classification Level Classification E-value
Superfamily ARM repeat 0.000144
Family MIF4G domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136943   Gene: ENSMUSG00000094374   Transcript: ENSMUST00000179295
Sequence length 373
Comment pep:known chromosome:GRCm38:12:82495419:82496537:-1 gene:ENSMUSG00000094374 transcript:ENSMUST00000179295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYSANTNTVPKLYRSVIEDVINDVRDIFLNDGVDEQVLTELKALWEKNLLQSRAVDGFR
SEEQQLLLQVQQQQQQQHYHHQHQQAQLQQTVPQQAQTQQVLIPASQQATAPQVIVPDSK
LLQHMNASSIPSAAATAATLALPAGVTPVQLLTNSSQLLQVVRAANGAQYILQPQQSVVL
QQVIPQMQPGGVQVPVIQQVLAPLPGRMSPQMGVIIQPQQILFPGNKTQVIPTTVAAPAP
AQAPMPAAGQQQPQAQPAQQQAPLVLQVDGTGDTSSEEDEDEDEEEDYDDEEEEDKEKDG
AEDGQVEEEPLNSDDDLSDEEGQEPFDTENVVVCQYDKIHRSKNKWKFHLKDGVMNLNGR
DYIFSKALEMQSG
Download sequence
Identical sequences ENSMUSP00000136943 ENSMUSP00000136943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]