SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138545 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138545
Domain Number 1 Region: 432-820
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.29e-131
Family Ankyrin repeat 0.000000000348
Further Details:      
 
Domain Number 2 Region: 188-450
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-72
Family Ankyrin repeat 0.00000314
Further Details:      
 
Domain Number 3 Region: 35-260
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-55
Family Ankyrin repeat 0.0000161
Further Details:      
 
Domain Number 4 Region: 3514-3624
Classification Level Classification E-value
Superfamily DEATH domain 2.86e-25
Family DEATH domain, DD 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138545   Gene: ENSMUSG00000032826   Transcript: ENSMUST00000182726
Sequence length 3954
Comment pep:novel chromosome:GRCm38:3:126922308:127225847:-1 gene:ENSMUSG00000032826 transcript:ENSMUST00000182726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNEDAAQKSDSGEKFNGSSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTC
NQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEG
ANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVA
ILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIA
AHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGL
TPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDD
VTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY
GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVV
RCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISARE
GQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPL
HVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTK
QGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGAD
RDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVL
LQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMT
EVLDVSDEEGDDTVTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLR
SFSSDRSHTLSHASYLRDSAMIDDTVVIPSHQVSALAKEAERNSYRLSWGTENLDNVALS
SSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPM
VEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSS
TVVSQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPI
TMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVAFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDK
VDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPL
FVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYAKESESDQEPEEEIGMTS
EKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSLK
VKELAKAGEEEPGEPFEIVERVKEDLEKVNAILRSGTCMRDEGRARSSQSERELEEEWVI
VSDEEIQEAKQHAPVEIDEHPCIEVRVDRETKAKVEKDSTGLVNYLTDDLNSYTSPHEKK
PHTAPEKSGETSQASAVGKSSESNKGKATSAEEKQSAQKQLKPGLAIKKPVRRKLKEKQK
QKEESSQSSEEKTELKKGSSEESVDEDRGLVPEPLPTAKATSPLIEETPIGSIKDKVKAL
QKRVEDEQKGRSKLPVRVKGKEDVPKRTTPRTHPAVSPSSKSSTSSKAERHSSLSSSAKP
ERHTPVSPSSKNEKLSPVSPSAKTERHSPVFSGKPEKHSPGSPSTKNERHSPVSSLKTER
HTPGSPSGKTDKRPPVPSSGRTEKHPPVSPGKTEKHLPGSPSIRTPEKPAPGSATGKHEK
HLPVSPGKTEKQPPISPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQ
PQDKSKSRVEKEKGHTVTQRETQRIESQTAKRGQRFQVSAATESRRFRSTTITVGLRMED
PVRERFERTPIIKTPEVVPSVAAEESHRGSEKIVDEQGDMDFQISPDRKTSTDFSEVIKQ
ELEDNDKYQQFRLTEDTEKAQVHLDQVITSPFNTAFPLDYMKDEFLPALSLQSGALGGSS
ESLKQEVIAGSPCSSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQIGEAK
ETTKVGTPTDIHSEKELPITNDITDSSQKQGAGVTRGSEPSTEHSQKEVTQDPHKDVCSK
QDGCPESQSVSLASEVFTEKGSCGESQLPLVSSAFKTQSESETQESLTPSEVTKPFPPSD
ASVKTAEGTEPKPQGAIRSPQGLELPLPNRDSEVLSPMADESLAVSHKDSLEASPVLEDN
SSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGILPSHFPLPAAIAKTDLVAEVASMR
SRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKPSDSSTPKPAVIH
ECAEEDDSENGEKKRFTPEEEMFKMVTKIKTFDELEQEAKQKRDYKKEPRQDGSSSASDP
DADYSAEVNDEKQMAGTEGEGEVPVLVTSENRKVSSSSSESEPELTQLSKGADSGLLTEP
VIRVQPPSPLPSSIDSNSSPEEATQFQPIVPKQYTFKMNEEIQEEPATSEDKDCKSHLAE
DSQTHSADAADGSDGDLNRETTQPETCDGHGCETVSPSNSATPVSLGVQSPEHKDVDKPL
AIDKDSLAHQDTCENDREEREFDPSGVESTQADLPNESSSLSSRCAIPEGNESAKEIASP
SSPVKVEVTITDQALESMPEDCPIQDSSTTMQTERFAMDVPVSELAETDENSDPQIISPY
ENVPSSSFFSAEPSKIQTDTCHSTVVHSPEVYSVIIRSSPEDVVVTNSSNRTVSGEESHC
ESHDLETESEQKSALWAAQSDAPPLAVAPTASDAASVTGEQASKVIITKTDADADSWSEI
REDDAAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKL
FEMTRSGAIDMTKRPYADESLHFFQIGQESNEEAISEDLKEGATGAEPPQTETTSESLEL
SEPKEAMDDEGELLPDDVSEEIEDLPASDANIDSQVIISASTETPTKEAVSTAVEEPPTT
QRSDSLSTVKQTPRPAVPGPVGQLDFSPVTRSVYSGQDDESPESSPEEQKSVIEIPTAPV
DNVPSAESKPQIPIRTLPTLVPAPPSAEDESAFSDDFPSSLDEDSKEGGAKPKSKIPVKA
PTQRTEWQPSPTDIPLQKTAVPQGQETLSRAPDGRSKSESDASSLDAKTKCPVKARSYIE
TETESRERAEGFESESEDGATKPKLFASRLPVKSRSTSSSGRPGTSPTRESREHFFDLYR
NSIEFFEEISDEASKLVDRLTQSEREQEPPSDDESSSALEVSVIESLPPVDIEHSAPEDI
FDTRPIWDESIETMIERIPDENGHDRAEDPQDEQERMEERLAYIADHLGFSWTELARELD
FTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTILIECLTKINRMDIVHLLETN
TEPLQERMGRSYAEIEQTITLDHSEGFSVLPDELCAAKEKKEQEASKESESSDHPPMVSE
EDISVGYSTFQDCLPKTEGDSPAAALSPQMHQEPVQQDFSGKTQDQQEYYVTTPGAEVED
PQKATAVPDSLCKTPEDISTPPEGTKPCLQTPVTSERGSPIVQEPEEASEPKEESSPRKT
SLVIVESTDDQSQVFERLDGDAAFQKGDDMPDIPPETVTEEEYVDENGHTVVKKVTRKII
RRYVSSDGTEKEEVTMQGMPQEPVNIEDGDNYSKVIKRVVLKSDTQQSEVTLSEPSVLSS
TSQFQAEPVEGRRVSKVVKTTMVHGERMEKSLGDSSLATDLPSAKDDFEEDNNE
Download sequence
Identical sequences ENSMUSP00000138545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]