SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138647 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138647
Domain Number 1 Region: 411-799
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.02e-131
Family Ankyrin repeat 0.000000000348
Further Details:      
 
Domain Number 2 Region: 167-426
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.69e-72
Family Ankyrin repeat 0.00000318
Further Details:      
 
Domain Number 3 Region: 14-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.51e-56
Family Ankyrin repeat 0.0000175
Further Details:      
 
Domain Number 4 Region: 1473-1582
Classification Level Classification E-value
Superfamily DEATH domain 1.27e-25
Family DEATH domain, DD 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138647   Gene: ENSMUSG00000032826   Transcript: ENSMUST00000182588
Sequence length 1851
Comment pep:novel chromosome:GRCm38:3:126921608:127408994:-1 gene:ENSMUSG00000032826 transcript:ENSMUST00000182588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTMLQKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQ
ELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQEN
HIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAAR
KDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDF
TARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLER
KAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVT
KLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFM
GHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPL
HIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATK
KGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGAS
PHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLL
LDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNV
KMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIA
KRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVLDVSDEEGDDTVTGDGGEY
LRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAM
IDDTVVIPSHQVSALAKEAERNSYRLSWGTENLDNVALSSSPIHSGRSSPCLDRDNSSFL
VSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASR
LIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRG
KERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQ
YFAVVSRIKQDSNLIGPEGGVLSSTVVSQVQAVFPEGALTKRIRVGLQAQPMHSELVKKI
LGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTT
PAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVAFASQVYREIICVPYMAK
FVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNL
VPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLN
ITLPIYAKESESDQEPEEEIGMTSEKNPQDEQERMEERLAYIADHLGFSWTELARELDFT
EEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTILIECLTKINRMDIVHLLETNTE
PLQERMGRSYAEIEQTITLDHSEGFSVLPDELCAAKEKKEQEASKESESSDHPPMVSEED
ISVGYSTFQDCLPKTEGDSPAAALSPQMHQEPVQQDFSGKTQDQQEYYVTTPGAEVEDPQ
KATAVPDSLCKTPEDISTPPEGTKPCLQTPVTSERGSPIVQEPEEASEPKEESSPRKTSL
VIVESTDDQSQVFERLDGDAAFQKGDDMPDIPPETVTEEEYVDENGHTVVKKVTRKIIRR
YVSSDGTEKEEVTMQGMPQEPVNIEDGDNYSKVIKRVVLKSDTQQSEDNNE
Download sequence
Identical sequences ENSMUSP00000138647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]