SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000139933 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000139933
Domain Number 1 Region: 119-182
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000654
Family B3/B4 domain of PheRS, PheT 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000139933   Gene: ENSMUSG00000026245   Transcript: ENSMUST00000188247
Sequence length 237
Comment pep:putative chromosome:GRCm38:1:78462996:78488859:-1 gene:ENSMUSG00000026245 transcript:ENSMUST00000188247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKGDIQKLVITEETAKVRPFAVAAVLRNIKFTKDRYDSFIELQEKLHQNICRKRALVAI
GTHDLDTLSGPFTYTAKRPSDIKFKPLNKTKEYTACELMNIYKTDNHLKHYLHIIESKPL
YPVIYDSNGVVLSMPPIINGNHSKITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEHCE
NQFTVEAVEVVSPNGKSSTFPELPYRKEMVRADLINKKVGIRETPANLAKLLTRMCL
Download sequence
Identical sequences A0A087WPV4
ENSMUSP00000139933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]