SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000141048 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000141048
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 6.67e-30
Family N-terminal domain of MutM-like DNA repair proteins 0.000000419
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.5e-26
Family Middle domain of MutM-like DNA repair proteins 0.0000022
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.42e-19
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000141048   Gene: ENSMUSG00000032298   Transcript: ENSMUST00000186410
Sequence length 389
Comment pep:known chromosome:GRCm38:9:57143070:57148305:-1 gene:ENSMUSG00000032298 transcript:ENSMUST00000186410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASHFVNETCKGLVFGGCVEKSSVSRNPEVPFESSAYHISALARGKELRLTL
SPLPGSQPPQKPLSLVFRFGMSGSFQLVPAEALPRHAHLRFYTAPPAPRLALCFVDIRRF
GHWDPGGEWQPGRGPCVLLEYERFRENVLRNLSDKAFDRPICEALLDQRFFNGIGNYLRA
EILYRLKIPPFEKARTVLEALQQCRPSPELTLSQKIKAKLQNPDLLELCHLVPKEVVQLG
GKGYGPERGEEDFAAFRAWLRCYGVPGMSSLRDRHGRTIWFQGDPGPLAPKGGRSQKKKS
QETQLGAEDRKEDLPLSSKSVSRMRRARKHPPKRIAQQSEGAGLQQNQETPTAPEKGKRR
GQRASTGHRRRPKTIPDTRPREAGESSAS
Download sequence
Identical sequences Q8K4Q6
ENSMUSP00000034842 NP_082623.1.92730 XP_006511548.1.92730 XP_006511549.1.92730 XP_011241120.1.92730 10090.ENSMUSP00000034842 ENSMUSP00000034842 ENSMUSP00000034842 ENSMUSP00000139917 ENSMUSP00000141048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]