SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20093737|ref|NP_613584.1| from Methanopyrus kandleri AV19

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20093737|ref|NP_613584.1|
Domain Number 1 Region: 99-282
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.36e-69
Family Formate/glycerate dehydrogenases, NAD-domain 0.00000772
Further Details:      
 
Domain Number 2 Region: 1-134
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 1.44e-43
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00022
Further Details:      
 
Domain Number 3 Region: 319-444
Classification Level Classification E-value
Superfamily Serine metabolism enzymes domain 8.11e-23
Family SerA intervening domain-like 0.0034
Further Details:      
 
Domain Number 4 Region: 438-519
Classification Level Classification E-value
Superfamily ACT-like 8.74e-18
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20093737|ref|NP_613584.1|
Sequence length 522
Comment D-3-phosphoglycerate dehydrogenase [Methanopyrus kandleri AV19]
Sequence
MAKILVTDPIHEDALRKLEELGEVVVLEDADEEEIREHVRDADAWVVRSGTRVTRELIEE
AKNLKVIARAGVGVDNIDVKAATERGIIVVNAPESSSISVAEHTMGLILALARKIPQADR
SVRRGEWDRKRFMGVELAGKTLGLIGLGRIGQQVAKRAKAFEMEVTAYDPYIPEKVAEEL
GVELVDELEELLERADVVSIHVPLTEETEGMIGEEELKRMKSSAFLVNCARGKIVDEEAL
IKALKEGWIAGAALDVFAEEPPGEDHPLYELDNVVLTPHIGGSTGEAQRAAGLIVAREIE
RVLKGEIPENVVNLPLAGVPDDVRELMEVGERLADAAAQVLEERLRWVQVKVGGELEDRE
KEALKRAVLKGCLDRVLTEPVTMVNAVDVAERRGIEFEFTVSDELEGGEVEVVVRSDEDE
ISLRGELVEDRVYLTSVNGYEVRFKLSGPTLFVWHVDRPGVIGEVGIILGEHRVNVAAME
VGRRERGGEAIMVIRMDEEPPEECLRAIDEVEPVRRVELVRC
Download sequence
Identical sequences Q8TYK0
gi|20093737|ref|NP_613584.1| 190192.MK0297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]