SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|20094222|ref|NP_614069.1| from Methanopyrus kandleri AV19

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20094222|ref|NP_614069.1|
Domain Number 1 Region: 16-127
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.000000000141
Family MJ1460-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20094222|ref|NP_614069.1|
Sequence length 131
Comment metabolic regulator [Methanopyrus kandleri AV19]
Sequence
MDELIKDLEEGAGEKGELLAEIVYERADSLEEMLELLEDMGMEGIKVDFVGDKEDPEEIV
ITVETTVTVEFYEENPEVKEEMGFTEPACELEQALFRKLAELKYDKSMEIEETKCQLAGD
DICKFRIVPKE
Download sequence
Identical sequences Q8TX90
gi|20094222|ref|NP_614069.1| 190192.MK0785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]