SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20094482|ref|NP_614329.1| from Methanopyrus kandleri AV19

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|20094482|ref|NP_614329.1|
Domain Number - Region: 8-200
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.000204
Family D-glucarate dehydratase-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|20094482|ref|NP_614329.1|
Sequence length 228
Comment O-succinylbenzoate-synthase-related enzyme [Methanopyrus kandleri AV19]
Sequence
MAVMDAEARSQGLPLAELLGGEPRTVESACSVHELGKHGALREARDNLSVGYTVVRVRAD
SAGLSSVSALDFETVLLEFTDRPSERALEEVRSVSDAEIVVISPEEFDAEVPIYVRVTSE
EDIHGLGSAEGVALSVQEVGFLDAVLLGRKARELGFKIIVLTEVESAVSVKAAAHLAGAL
RAEYCDLSGHLALYEDLESLGYAPEVELTGPGREVRVNHDPYELAEAP
Download sequence
Identical sequences Q8TWI8
gi|20094482|ref|NP_614329.1| 190192.MK1046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]