SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15828600|ref|NP_325960.1| from Mycoplasma pulmonis UAB CTIP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15828600|ref|NP_325960.1|
Domain Number 1 Region: 8-149
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 4.19e-31
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0022
Further Details:      
 
Domain Number 2 Region: 172-267
Classification Level Classification E-value
Superfamily PTS system IIB component-like 4.71e-29
Family PTS system, Fructose specific IIB subunit-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15828600|ref|NP_325960.1|
Sequence length 698
Comment PTS system, fructose-specific IIABC component (EIIABC-fru) (fructose-permease IIABC component)(phosphotransferase enzyme II, ABC component) (EII-fru/EIII-fru) [Mycoplasma pulmonis UAB CTIP]
Sequence
MQISYFLKNKNFIYFNKEFKDKNQALKFFSNQLLTQGYAHEEKKVFDLFVQRENELSTGI
GDSIALPHIRSDVMKKSTLMFAKVKDLNWDSLDGKNVKYIFVIAMSKDEGQNSHLEVIAQ
LSKLLLNKDFINNLNSINEAEKFISLVDKFENQLLQDEAKNDVIQKSNEDYEIVAVASCP
TGIAHTYLAAQRLVETAKDMKVKIKVETQGAQGSKNVLSSRDIEKAKGVILAIDREIEKQ
RFFNSENVIETSTREAIHNPKNLIEKSRNLQGKKIKASQPISQEDTQGGYTFDNFFKRMY
RSLMSGISYMLPFVVFGGIIISIGFLIDTIYGATSGISSDPKFLANFGSNHIVAKWFNRL
GGIAFSIMVAILAAYITYSLVGRQGLLPGFVIGFISSGRLKDTYSFLTDSLTNNYGLSPD
KVLETGSGFVGAILGGFFAATMLILMSKYIFSKLPKNLYGIRDILFIPILGTLTIAFVFW
VLNIVFIYINYGLTILLLIIETRREIIWLLGLILGIMMAVDLGGPINKAAYVFGTLTLAQ
MQGKGTIAMASVMIAGMTPPLGISVSMFLHKKLWSKQDIEAGKISNILFGLSFISEGAIP
YTSRNTKVMIPSNIIGSAVASLLSASLGVSIAAPHGGIFVFFLARSSLFESQGLSIAFGI
LFLIGSIIIGSFVSAFSIYFLTKFYQKRQAKKESLKTK
Download sequence
Identical sequences Q98R81
gi|15828600|ref|NP_325960.1| WP_010924933.1.72207 272635.MYPU_1290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]