SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15828634|ref|NP_325994.1| from Mycoplasma pulmonis UAB CTIP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15828634|ref|NP_325994.1|
Domain Number 1 Region: 31-168
Classification Level Classification E-value
Superfamily RNase III domain-like 5.06e-32
Family RNase III catalytic domain-like 0.00041
Further Details:      
 
Domain Number 2 Region: 131-239
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000000189
Family Double-stranded RNA-binding domain (dsRBD) 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15828634|ref|NP_325994.1|
Sequence length 241
Comment ribonuclease III (RNase III) [Mycoplasma pulmonis UAB CTIP]
Sequence
MRKKTSWNINTHIQKHFKDLVFELNKLGINQISQKEKNIFFQAFTHTTFHNLYKAKSYEM
LEFLGDAILQKNVSEYIFKNTESNKINPGTATLIRSKLVNKTCLSNLAKELKLDKFLLLP
KGQEELVKNEKVLSDLFESLCAAIYITKGNDVLEVFLQKYLYPKMQDLEYKTLKNAKGRF
QEIFQATTKSAGKYVISFDEEKKIYEAKLIHSETIYGIGYGKNKKEAEQNAAEDALKKLV
I
Download sequence
Identical sequences Q98R47
272635.MYPU_1630 gi|15828634|ref|NP_325994.1| WP_010924967.1.72207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]