SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15828659|ref|NP_326019.1| from Mycoplasma pulmonis UAB CTIP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15828659|ref|NP_326019.1|
Domain Number 1 Region: 12-245
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.16e-50
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000498
Further Details:      
 
Domain Number 2 Region: 253-352
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 6.28e-17
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15828659|ref|NP_326019.1|
Sequence length 425
Comment DNA-damage repair protein MucB [Mycoplasma pulmonis UAB CTIP]
Sequence
MLVKIIFMLKSKVIFHLDADSYFVSAIRTIRKDLFGKSMVVAHNHKRAIITSASYEAKAK
GIKVGMPLYKAKLIDPNVVVADYSFELYSNLSSNIFNFLYENYTKKIQIYSIDEFFIDAS
DLVVKKGSILKLAQEMQKAIMDNFSIPFSIGVGPNLWMAKMSTSINKPYGITITKRSDLK
KNIYSQDISEYVGIGKSGLAKLSHLNIKTIGDFCNSVFAQGALEKIYGIKLKTIKEECQG
ISNDQIDTSQNDAQSLGSEISFSHDDLDERSSIFNYFKLICELLEKKLKNRGIYANTLTV
KLRDQNYKWKTKRKKYSIKLFESQDIMNRVIEIFNQFWDEKKLRGLGISLSDFGDIYQSD
LSFDLFDQKYDSKKEKINALIKSINKDKTRKVIYFLNEYQDSQIHKSKQSKFIKNEQKKI
KKTSL
Download sequence
Identical sequences Q98R22
WP_010924992.1.72207 gi|15828659|ref|NP_326019.1| 272635.MYPU_1880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]