SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15828824|ref|NP_326184.1| from Mycoplasma pulmonis UAB CTIP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15828824|ref|NP_326184.1|
Domain Number 1 Region: 2-155
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 3.14e-45
Family Obg GTP-binding protein N-terminal domain 0.00000846
Further Details:      
 
Domain Number 2 Region: 158-335
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.63e-45
Family G proteins 0.0000145
Further Details:      
 
Domain Number 3 Region: 344-416
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 1.57e-21
Family Obg GTP-binding protein C-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15828824|ref|NP_326184.1|
Sequence length 418
Comment GTPase ObgE [Mycoplasma pulmonis UAB CTIP]
Sequence
MKFIDEITLNVKAGKGGNGMIAFRREAHVDRGGPSGGDGGNGGNIYFVGDLGKNTLLHLY
LQKSIVGNNGVNGGRKNLYGAAGEDKFIKVPVGTVVYEGQKVIADIVEEKPYLIAKGGRG
GRGNTKFKTAKNKAPRISENGLPGESKKLTLVLKVLADVGFVGKPSAGKSTLLSVISNAK
PTIADYDFTTLVPQLGLVKYFDNSFVVADLPGLIKGAHQGKGLGIRFLKHIERCKVIANV
IDFGDENKNPLQDYQEIRNELKLYNLNLEEKDEVIVANKKDQECFEKKLEEFSKHYPNKK
IIAISALKQENLDKLKEALWQSVKNTKDIVFELSEDEEVFINFEADFNVVHLGEGQYLVE
GPKIHHFYQRIPLNTHDNLMRFNLILKKMGVWDELIKQGIQIGDSVKIYDYEFVWGNE
Download sequence
Identical sequences Q98QK8
gi|15828824|ref|NP_326184.1| 272635.MYPU_3530 WP_010925157.1.72207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]