SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15828972|ref|NP_326332.1| from Mycoplasma pulmonis UAB CTIP

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15828972|ref|NP_326332.1|
Domain Number - Region: 35-92
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0193
Family Ricin B-like 0.024
Further Details:      
 
Domain Number - Region: 77-140
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 0.0667
Family Obg GTP-binding protein C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15828972|ref|NP_326332.1|
Sequence length 157
Comment hypothetical protein MYPU_5010 [Mycoplasma pulmonis UAB CTIP]
Sequence
MKNSTNNIGFDLRIHFLDNQQLRFSNSKISIVSESENQFFVLDPNSVASYEKNLIEIENL
KTKNKKYVFLKNCNVLVSDNNIWVNSSNKKNLYEKTNKKINNKEKIKTLSKELAEFNLMQ
KIGIDFEDFLKISEIEYQIYKEQMKELFKLEEFEHEK
Download sequence
Identical sequences Q98Q67
272635.MYPU_5010 gi|15828972|ref|NP_326332.1| WP_010925302.1.72207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]