SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15829012|ref|NP_326372.1| from Mycoplasma pulmonis UAB CTIP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15829012|ref|NP_326372.1|
Domain Number 1 Region: 168-695
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.16e-169
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0000000000418
Further Details:      
 
Domain Number 2 Region: 8-167
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 4.05e-48
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15829012|ref|NP_326372.1|
Sequence length 711
Comment ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma pulmonis UAB CTIP]
Sequence
MTKKKNQEKYINLNAMAKLYWQDGQNINYDLQAAHDYYESKIKPHFRVFESFEKRIEFLV
KNNYYEKSLIDQYTISQLKELNDLAYSYNHFFPSFMGILKFYNAYALKSFDGKEYLENFE
DRALMNALFLANGDFEKAKAILKEIMLKRFQPATPTFLNAGKAQRGEYVSCYLIRTEDNM
ESISRSITTSLQLSKRGGGVAVLLTNLRELGAPIKNIQNQATGIIPIMKILEDSFSYANQ
LGQRQGAGAVYLNIHHPDILQFLDSKRENADEKIRIKSLSLGLVVTDIAFELAKNNEKLA
LFSPYDIQKEYKKPMSDISITQEYYNLLKNDKIKKTYINARKLFTLIAELHFESGYPYLL
FDDTVNRRNAHPNRIVMSNLCSEIVQPSTASEYSADLSYTKVGDDISCNLGSLNIAKALE
SGREFKSLVANSIFALNQVSRKADLSSAPSIEKGNNKNHAIGLGAMNLHGFLANNEIFYN
SQEALDFTNMFFYAMAYYAFEASQELSLIYGKFHGFEKTKFADGSYFEKYTKGDENKWKA
KTKKVQDILEKYDFYIPSQKDWIELVEKIKKTGIANSHLMAIAPTGSISYLSSCTPSLQP
VVAPVEARKEGKLGRVYVPAYNLNSNNFKYYIEGAYEMGPIPIIDIAAEAQQHIDQAISL
TLFLTDKATTRDLNKAYIHAFKKGCSSIYYVRVRQDVLENSENYECESCAI
Download sequence
Identical sequences Q98Q28
WP_010925342.1.72207 gi|15829012|ref|NP_326372.1| 272635.MYPU_5410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]