SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15829041|ref|NP_326401.1| from Mycoplasma pulmonis UAB CTIP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15829041|ref|NP_326401.1|
Domain Number 1 Region: 142-221
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.97e-24
Family Translational machinery components 0.00058
Further Details:      
 
Domain Number 2 Region: 71-138
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.72e-22
Family Ribosomal S5 protein, N-terminal domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15829041|ref|NP_326401.1|
Sequence length 229
Comment 30S ribosomal protein S5 [Mycoplasma pulmonis UAB CTIP]
Sequence
MEKEKNKKFDSSSFKKEEKSNLAWKKEAKATKEIIKKDDEMEVVTEESQSKNEGNFKARR
KVKKVISKPKTEFSEKIVDIARVTKVVKGGRRFSFSAFVVVGNKKGKVGYGHGKANEVPD
AIKKAIKDAQNHLITVPIINESTVPHEMSGKFLSSKVIIKSAPKGKGIIASGAVRAVMEL
AGYTDIYAKSYGSRTKMNTVKATVETLKKMRTVEEIAALRGLKVQDIIS
Download sequence
Identical sequences Q98PZ9
gi|15829041|ref|NP_326401.1| 272635.MYPU_5700 WP_010925371.1.72207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]