SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15829222|ref|NP_326582.1| from Mycoplasma pulmonis UAB CTIP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15829222|ref|NP_326582.1|
Domain Number 1 Region: 250-340
Classification Level Classification E-value
Superfamily PTS system IIB component-like 5.23e-17
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15829222|ref|NP_326582.1|
Sequence length 342
Comment PTS system, mannitol-specific IIABC component (EIIABC-MTL) (mannitol-permease IIABC component) (phosphotransferase enzyme II, BC component) (EII-MTL), partial [Mycoplasma pulmonis UAB CTIP]
Sequence
MLVNNFSLVIIGFILLFPTFYLSIYVIGYLNLALSYMVDGMQKYKLYPILAIVVEPAKVL
FLNNAINHGVFTMLGQSEVLEKGKSILFLLESNPGPGLGVLIAWIIFGKKEDKNVRTQAI
SSSPIHLFGGIHEVYFPFVLLKPVLIVSTIAGGAIGNLIFQIFNVGALAPVSPGSIIAAY
IQVNKSANDLVGLTLGILSSALVSLFVSSMILAFDRIFKKNKKVTKEKTLESALQESKAN
KLKIDNKKEYEFIFVCIAGMGSSAMGATIFKNILKNNNINNIKVSNKSISNLDGQEKNII
TINHLVEKVKEKNSIANIYSIRQFLDKNDYQNIVDQIKNEKI
Download sequence
Identical sequences Q98PH1
272635.MYPU_7510 gi|15829222|ref|NP_326582.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]