SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384159088|ref|YP_005541161.1| from Bacillus amyloliquefaciens TA208

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384159088|ref|YP_005541161.1|
Domain Number 1 Region: 150-530
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.26e-73
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0048
Further Details:      
 
Domain Number 2 Region: 577-798
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.96e-42
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384159088|ref|YP_005541161.1|
Sequence length 944
Comment 2-oxoglutarate dehydrogenase E1 component [Bacillus amyloliquefaciens TA208]
Sequence
MFQNNMKQRMNWEDFYGPNLGYALELYDQYAEDPDSIDPDLKDMFDELGAPPSQIKEASG
TKEQGRVTADLIQKIAAAVKLAEDIRTYGHLNASVNPLRKDQKKSELFPLSEYGLTEEEM
KAIPASVICKDAPANITNGLEAIQHLRNTYKRTISFEFDHVHDFEERAWITKMVESGELF
RKNSPEKLSAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAQSVKAGTT
NVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSTGISYGWTGDVKYHLG
ADRQLQDAETKSARITLANNPSHLEFINPIVEGSTRAAQETRTQKGYPVQDETKSLAILI
HGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIGFTTESDESRSTKYASDLAKGY
EIPIVHVNADDPEACLSAVKFAVEYRKRFNKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHPTVKRIFAEKLVSEGLISEEKAQNIEATVTKRIEDAYKKVPAKKEDAVREIELPE
PVSNGFPDVDTAIDFDVLRKLNGELINWPESFNVFGKLKRILERRAKAFDDDRKVEWSLA
ESLAFASILKDGTPIRLTGQDSERGTFAQRNLVLHDSETGKEFVALHHLDDCAASFAVHN
SPLSEGSVLGFEYGYNVYSPETLVMWEAQYGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRVERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNTVSEVQELSESRFKPVYEQSGLSHAYEKVTRVVLSSGKVSIDISDHF
NKMEGDKDWLHIARIEQLYPFPAKDAKELFAKLPNLQEIVWVQEEPQNMGAWSYISPYLT
EIAPKGVNVQYIGRRRRSSPAEGDPTVHKKEQERIVSDSLTRKN
Download sequence
Identical sequences A0A0A0TPY4
gi|384159088|ref|YP_005541161.1| WP_014470298.1.1325 WP_014470298.1.54561 WP_014470298.1.65712 WP_014470298.1.70510 WP_014470298.1.77113 gi|384168128|ref|YP_005549506.1| gi|384164495|ref|YP_005545874.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]