SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014182 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014182
Domain Number 1 Region: 52-101
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.88e-19
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000808
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 7.85e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014182   Gene: ENSMEUG00000015534   Transcript: ENSMEUT00000015578
Sequence length 109
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_5060:5503:18831:-1 gene:ENSMEUG00000015534 transcript:ENSMEUT00000015578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRG
SLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTAE
Download sequence
Identical sequences F6TJT9 G3WEX4
ENSMEUP00000014182 XP_001374038.1.35504 XP_003755654.1.9362 XP_004628918.1.9945 XP_007479567.1.35504 XP_007479568.1.35504 XP_012398426.1.9362 XP_020824320.1.61212 XP_021490060.1.76796 ENSMEUP00000014182 ENSSHAP00000013979 ENSSHAP00000013979 ENSMODP00000014575 ENSMODP00000014575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]