SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008603 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008603
Domain Number 1 Region: 189-228
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000785
Family SOCS box-like 0.0027
Further Details:      
 
Domain Number 2 Region: 115-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000352
Family G proteins 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000008603
Domain Number - Region: 11-39
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0546
Family G proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008603   Gene: ENSMEUG00000009425   Transcript: ENSMEUT00000009456
Sequence length 281
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9549:2367:38363:1 gene:ENSMEUG00000009425 transcript:ENSMEUT00000009456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGASESPYAYSNXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAPGVP
RILVGNRLHLAFKRQVPTEQARSYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGM
EKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRS
YSLASSGGGSGSKGNSLKRSKSIRPPQSPPQNCSRSNCKIS
Download sequence
Identical sequences ENSMEUP00000008603 ENSMEUP00000008603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]