SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012473 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012473
Domain Number 1 Region: 493-585
Classification Level Classification E-value
Superfamily TAFH domain-like 5.62e-29
Family TAFH domain-like 0.0000103
Further Details:      
 
Domain Number 2 Region: 778-826
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000837
Family TBP-associated factors, TAFs 0.00039
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000012473
Domain Number - Region: 333-405
Classification Level Classification E-value
Superfamily Connexin43 0.0876
Family Connexin43 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012473   Gene: ENSMEUG00000013666   Transcript: ENSMEUT00000013713
Sequence length 991
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_4026:2382:29355:-1 gene:ENSMEUG00000013666 transcript:ENSMEUT00000013713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSDLLDEVFFNSEVDEKVVSDMVGSLESQLAASTAHHHHHPHRTPEIRAGGAGGLGN
HVVSGSPGGAGVVGPAAAAAGASGLAQEITKAGRARPGGGGAAGPGGKIGTTATVQTLNG
SNVVMNSHHAAAPAVTLVNNGPGSVVLPLGKSASSNTVIQTSSFLSTAVSSSSSPTVISS
SSIGSAGPTVALVRPPIHTAGPAAASVAAATQNGSNTVTATAAASVATVGPSGINSQPGS
NMPATATTQVIKSESPKTIVQAVPQQQTLTTSGQSTAGGNMIIGQTMQGGIPNPDTTPPP
APGTPTGMAKGTANTVAQSLPRTPTATTGGIRATLTPTVLAPRLPQPPQNPTNIQNFQLP
PGMVLLRHENGQLIMLTQQNLAQLQAQAQTQSQPQNTMALCPATTSAPPLQIATVQAPGT
KIIAQQGTPTTTIKQVSQAQKTVQTTTLQRPLAVQPQIIVGGSAQTSALGTASTVQAATP
QMAKQGATTTPAVATEARENGKKCQVFLSALIKLASSGKLSTETAAKIKELVQNLLDGKI
EAEDFASRLYQELNSSPKSYLVPFLKKSLPALRQLAPDSAAFIQENQQQQPRTKATKASP
AVVLSNSLQSTAGKTSATVTGALQPPVRGQKQPAALNVSKQAQPTPLVIQQPRKPGTLII
RPSQVILTKIPKVALRQPHDPLILTTQQIQLNQLKTIPAAKPPVLPDTKTLSSVSAPAAA
AQHSKPKELATDSFGNDDDTNDVASMAGVNLSEESARILATNSGLVGTLKRSCQDEAFLL
SEPLRRRILEISKKHGITELHPDVVSYVSRATQNRLQNLIEKVSEIAQHKNISYKNDERY
EQESHVRAQLKFFEELGQIEKWRKDEQERDILMRAAKSRSRQEDPEQLRLKQKAKEMQQQ
ELAQKRQRDANLTALEAIGPRKKRRVNSLESGSWTEGSGTSTAVPGGSGVGTTRQFTRQR
ITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences ENSMEUP00000012473 ENSMEUP00000012473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]