SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013967 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013967
Domain Number 1 Region: 2265-2538
Classification Level Classification E-value
Superfamily BEACH domain 2.75e-115
Family BEACH domain 0.0000000000645
Further Details:      
 
Domain Number 2 Region: 2148-2231
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-21
Family PreBEACH PH-like domain 0.0000152
Further Details:      
 
Domain Number 3 Region: 2676-2706,2800-2937
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000343
Family WD40-repeat 0.01
Further Details:      
 
Domain Number 4 Region: 222-359
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000665
Family Clostridium neurotoxins, the second last domain 0.041
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000013967
Domain Number - Region: 119-232,530-598,665-722,805-875
Classification Level Classification E-value
Superfamily ARM repeat 0.0282
Family Armadillo repeat 0.057
Further Details:      
 
Domain Number - Region: 2584-2708
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0915
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013967   Gene: ENSMEUG00000015292   Transcript: ENSMEUT00000015345
Sequence length 2943
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9276:8124:313943:1 gene:ENSMEUG00000015292 transcript:ENSMEUT00000015345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEKPGPGPGPGPEPQPAGLIAVGAGAGGGPGGGSCGGGGGVSGLGELRGASGSGSMVL
PAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRDIVETVLNLLVGGEFDLEMNFIIQDAE
SITCMSELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSTVDDMIAD
LLVDMLGVLASYSITVKELKLLFSMLRGENGIWRHAVKLSVLNQMPQRHGPDTFFNFPGC
SAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKPYLYXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTFKF
KSESDIHLAEHHKQVLYDGKLASSIAFTYNAKATDAQLCLESSPKENASIFVHSPHALML
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATLLAFLVELLKSS
VSMQEQMLGGKGFLVIGYLLESSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHIL
FNPAIWIHTPAKVQLSLYTYLSAEFIGTATIYTTIRRVGTVLQLMHTLKYYYWVINPADS
SGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENI
HDVLQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
RKVEIMHTHSLFTLLGERLMLHTNTVTVTTYNTLYEILTEQVCTQVVHKPHPEPDSTVKI
QNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTYEAHKEYLA
KMYEEYQRQEEENIKKGKKGNVSTISGLSSQATGAKGGMEIREIEDLSQSQSPESETDYP
VSTDTRDLLMATKVSDDVLGNSDRPGGGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPE
TLVTGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKSEEKDNGPLITLADEKDEP
TSNSTSFIFDKIPSQEEKLLPELSSNHIIPNVQETQVHLSVSDDLGLLAHMTSSVDLTCT
SSIIEEKEFKIHTTSDRMSSISERELASSSKGLEYAEMTATTLETESSGSKIVPNIDAGS
IISDTERSDDGKEAGKEIRKIQTTTTTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCCVAVRNCLECRQRQRERVNKSSL
ISSKPQEAPQSVTAGATSKTPLESVPGNLSPIKDPDRLLQDVDINRLRAVVFRDVXDSKQ
AQLALAVVYFISVLMVSKYRDILEPQRETARSGSQAGRNMRQEINSPTSTVVVIPSIPHP
SLNHGFLAKLIPEQSFAHSFYKETPAAFQENMKEKETTTPGDEIQLESSIPHTDSGIGEE
QIPSILNGAELETSAGPDAMSELLSTLSSEVKKSQESLSESPNEMLKPAPSISSISQTKG
INVKEILKSLVAAPVEIPECGPDPLPYPDPALKREAHAILPMQFHSFDRSVMPEKKAPPG
SLAVTTVGAATAGSGLPASTPNIFAATGATPKSMINTXXAVDSGSSSSSSSSSFVNGATS
KNLPAVQTVAPMPEDSAENMSITAKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQEL
LIEXXXXXXXXXXXXXXXXXXXXXEWQNSIQKNAGLAFIELINEGRLLHAMKDHIVRVAN
EAEFILNRQRAEDVHKHAEFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXQLHDFWRLDYWEDDLRRRRRFVRNAFGSTHAEALLKATTEYGT
EEDVLKSKKTFRSQAVVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLSTPAQLIAP
VVVAKGTLSITTTEIYFEVEEDDPAFKKIDPKVLAYTEGLHGKWMFSEIRAVFSRRYLLQ
NTALEVFMANRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRISLATPRQLYKSS
NMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEELDLTLPGNFRDL
SKPVGALNPKRAVFYAERYETWEDDQSPPCHYSTHYSTAPSTLSWLLRIEPFTTFFLNAN
DGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVN
DVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFHYLTY
EGSVNLDSITDPVLREXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCFLPQSPLMFKDQM
QQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSL
DQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRYILICGFWDKSFR
VYSTETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCLVHTITGDLLRALEGPENC
LFPRLISVSSEGHCIIYYERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQNLVTGGDN
GVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQ
NRY
Download sequence
Identical sequences ENSMEUP00000013967 ENSMEUP00000013967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]