SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011698 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011698
Domain Number 1 Region: 9-183
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.05e-67
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000441
Further Details:      
 
Domain Number 2 Region: 185-243
Classification Level Classification E-value
Superfamily E set domains 0.000000000003
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011698   Gene: ENSMEUG00000012828   Transcript: ENSMEUT00000012863
Sequence length 662
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_858:5040:41165:1 gene:ENSMEUG00000012828 transcript:ENSMEUT00000012863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSSLPPLDWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNE
KPINLQMFIGTADDRYRPHAFYQVHRITGKTVATASQEVIIASTKVLEIPLLPENNMSAR
VDCVGILKLRNADVEARIGIAGSKKKSTRARLVFRVNITRKDGSTLTLQTPSSPILCTQR
SAQELPHIEKYSINSCPVSGGHEMVVTGANFLPESKIIFIEKGQDGRPQWEVEGKIIREK
CQGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLMKQEHREEMDLSS
VPSLSMPQSGNIQGLPSPSSDPGQPHDSLLTSSLVCPIQQPYTSLVTSSASHLSQIQSRN
ISPGEECHGMPSVLHQSFQATSAPPMRSSYQPMQTNVMYNGQTCLPINAASSQGFDANSF
QQDTAVPNLINLSCQPLPSLQFHSSNSGSAGHPLVHTTHSEQSLPHLQPVGYHYSNTGQA
PVTSTTSQSLGQPSPHLQPGTYHTSNPGSATISSPTASHPLVHSPLSGPPSPQLQPMPYQ
SPSSGPASSPSPTTITHSGQPSPQAHSPGVGGISVPSSLVCQHRCDSSSFSPDGAVMNIK
PEPEDQELNFETIGLQDITLDDVNEIIGRDMSQISVSRGATVTIQPRSEVPDSLDSGMSD
GV
Download sequence
Identical sequences ENSMEUP00000011698 ENSMEUP00000011698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]