SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53803336|ref|YP_114897.1| from Methylococcus capsulatus str. Bath

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53803336|ref|YP_114897.1|
Domain Number 1 Region: 372-849
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 1.96e-151
Family Aconitase iron-sulfur domain 0.000000000000306
Further Details:      
 
Domain Number 2 Region: 162-365
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 5.69e-67
Family LeuD-like 0.0000000586
Further Details:      
 
Domain Number 3 Region: 1-160
Classification Level Classification E-value
Superfamily Aconitase B, N-terminal domain 2.88e-65
Family Aconitase B, N-terminal domain 0.000000482
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|53803336|ref|YP_114897.1|
Sequence length 858
Comment bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase [Methylococcus capsulatus str. Bath]
Sequence
MLTQYREHVAERAAQGLVPKPLTAEQTAALVELLKSPPAGEEAFLLDLLSNRVPAGVDEA
AYVKAGFLAAVARGEAVSPIVSPRRATELLGTMLGGYNVAPLIELLDHSELAPVAAHGLS
RTLLMFDAFHDVQVKAEAGNVHAQAVLRAWADAEWFTSRPEVPGKLTVTVFKVPGETNTD
DLSPAQDAWSRPDIPLHAKSMLKVPREGIHDAEAQIAELKTKGFPVAYVGDVVGTGSSRK
SATNSLLWYIGEDIPHVPNKRQGGVCIGGKIAPIFFNTLEDSGALPIECDVTAMQTGDVI
DIHPYEGVLRNHESGVELCRFTLKTEILLDEVRAGGRINLIIGRGLTDRARKVLGLPPSE
VFRRPRAPIETGKGYTLAQKIVGKACGVAGIRPGTYCEPAMTTVGSQDTTGPMTRDELKD
LACLGFSADLVLQSFCHTAAYPKPVDVETHHTLPDFIMNRGGVSLRPGDGIIHSWLNRML
LPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPESVLVRFKGEMQPGITLR
DLVHAIPYVALQRGLLTVEKQGKKNVFSGRILEIEGLPDLKVEQAFELADASAERSAAAC
TIKLDRAPIEEYLHSNITLLRWMIAEGYGDARTLRRRIAAMEAWLADPQLLEADPDAEYA
EVIEIDLDQITEPLLCCPNDPDDVKPLSQVAGTHIDEVFLGSCMTNIGHFRAAGRLLEAF
GKPTPTRLWIAPPTRMDQAQLTEEGYYATYGKAGARTEMPGCSLCMGNQARVADNATVVS
TSTRNFPNRLGAGARVFLASAELAAVCSILGRIPSLEEYMAYAGKIEEKAADTYRYLNFD
RTPAYAERAAKVKDLEMA
Download sequence
Identical sequences Q604Q3
WP_010961708.1.29143 gi|53803336|ref|YP_114897.1| 243233.MCA2485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]