SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53802721|ref|YP_115498.1| from Methylococcus capsulatus str. Bath

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|53802721|ref|YP_115498.1|
Domain Number - Region: 105-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000562
Family NfeD domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|53802721|ref|YP_115498.1|
Sequence length 147
Comment hypothetical protein MCA3111 [Methylococcus capsulatus str. Bath]
Sequence
MTGFSLVFWHWWTLGALLLILELLLPGMYFLWMAEAALLTGAVLWLLPGLGWEIQLLVFS
VLSLASIFVFEKFIGRKPIVSDRPLLNRRAAQYIGRTLMLEQPIVNGMGKIRIDDSIWRV
HGDDCPAGTKIRVCDVDGVILKVERVA
Download sequence
Identical sequences Q602F2
gi|53802721|ref|YP_115498.1| WP_010962295.1.29143 243233.MCA3111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]