SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53804410|ref|YP_113955.1| from Methylococcus capsulatus str. Bath

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53804410|ref|YP_113955.1|
Domain Number 1 Region: 9-160
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 5.14e-41
Family Deoxycytidylate deaminase-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|53804410|ref|YP_113955.1|
Sequence length 164
Comment zinc-binding domain-containing protein [Methylococcus capsulatus str. Bath]
Sequence
MRTSVSPGEQDRAYMRLAIQTMRRAGIVDRTGGPFGAVIVRGGQVLAVAGNSVIRDNDPT
AHAEINAIREACRRIGSYDLSGAVLYSSCECCPMCYASAYWARIDQIYYAASWHDYEDLF
DDSRIHEDIVKSYAERHLAPQQIMREEALEVWREFRALPNGARY
Download sequence
Identical sequences Q608J2
243233.MCA1498 gi|53804410|ref|YP_113955.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]