SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384170578|ref|YP_005551956.1| from Bacillus amyloliquefaciens XH7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384170578|ref|YP_005551956.1|
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 5.1e-37
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384170578|ref|YP_005551956.1|
Sequence length 110
Comment PTS system lichenan-specific transporter subunit IIA [Bacillus amyloliquefaciens XH7]
Sequence
MNEKMEQTIFQIILHGGNGRSASMEAIAAAKQGDRALAEKKLQEAARELTEAHHYQTELI
QNEAGGEKTDMTLLMVHAQDHLMNAMTVKDLAAELVAIYEKVSLQGGATI
Download sequence
Identical sequences A0A1Y0XE24
gi|308175579|ref|YP_003922284.1| gi|384161470|ref|YP_005543543.1| gi|384170578|ref|YP_005551956.1| WP_013354066.1.1127 WP_013354066.1.1325 WP_013354066.1.33972 WP_013354066.1.54561 WP_013354066.1.65712 WP_013354066.1.70207 WP_013354066.1.80835 gi|384166378|ref|YP_005547757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]