SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr0191s0030.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr0191s0030.1
Domain Number 1 Region: 276-438
Classification Level Classification E-value
Superfamily BRCA2 helical domain 3.14e-41
Family BRCA2 helical domain 0.00058
Further Details:      
 
Domain Number 2 Region: 439-568
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.42e-39
Family Single strand DNA-binding domain, SSB 0.00014
Further Details:      
 
Domain Number 3 Region: 571-600,718-801
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.11e-21
Family Single strand DNA-binding domain, SSB 0.0094
Further Details:      
 
Domain Number 4 Region: 601-718
Classification Level Classification E-value
Superfamily BRCA2 tower domain 6.28e-18
Family BRCA2 tower domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr0191s0030.1
Sequence length 808
Comment | breast cancer type 2 susceptibility protein | HC | scaffold0191:30338-23519 | 20130731
Sequence
DSFGFSNSLFKTASGRKVTLSSNGLVRAKTLLGLGLQEEIIDSNNHTPKNAKNFHGFDEE
SPPLVSKSKNGFENKIVQIESGSGSKKAPIKFQTPQNSDSGAKQAQFKFQTAAGRSLSIS
SDALKRARSLLGDPDLGDFFEGEDSLFLSLDMRQISKITSSVGHQKTPESNKNHVTKSFT
YPLQPSKQTEFSNKLLGHEGNGNNLIMKFDDVANESDYGCKSSNTLEVVDLTRKSSSLGT
TFFDVSSTTKTTPTFNKQPAIGKRRLGLTANVSSFKKPRISKTSASGDQHVQNFHNGLSK
LSSGASGCKRKVSTRYPSRNARIHIKEFFAVPPLMKKVHFPNPVRQVTSGNAGEYIFHDG
SDDNGIGGEAFIHLLAQHGASLHFASKEWVLNHYKWIVWKLACYERYYPARCAGKFLTVS
NVLEELKYRYEREVNHGHRSIIKKVLEGDILPSSMMILCISSIHSNHVMESGTLFQAQTG
NKSREAVKVELTDGWYSINAILDAPLSKQLDAGRLFVGQKLRIWGAELCGWNGPVSPFEV
SSTISLFLHINGTYRVHWSARLGFCKVAGPPLAFKCIKNNGGLIPQTLAGITLIYPILYK
ERLSSERSVVLSERMENKMMELHNQRCSAVVDNIVSEYQKERTSSHVYDHDDSEGAKIYM
MLETAAEPEFLMADMTLEQLRSFAAYKAKLNATRQSQLESSIEKALKDSGLGNRDVTPFM
KLRVVGLTYKNRQDKPKEGIITIWNPTQKQCQELAEGEAYAIAGLTPYGSDPDVLHLQTR
GSTTKWLPLSSNAKEQFRSFFNSRKSIP
Download sequence
Identical sequences A0A072THI9
XP_013442393.1.50012 Medtr0191s0030.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]