SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr0353s0010.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr0353s0010.1
Domain Number 1 Region: 837-869
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.000000471
Family H-NS histone-like proteins 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr0353s0010.1
Sequence length 1049
Comment | H-NS histone family protein | LC | scaffold0353:1725-5137 | 20130731
Sequence
CGALWNQHRKAKQPVKGEPPLSPDSTAFPNSKPRAAPRAANSAPPRTSTAPSSLSLDTMP
PDHFFETDLNQDKPEVFSIRTAPRAFSAAGLTAHWVPAGMRVNVHHFSLPDGLVYLCGSA
GRDGLTKAEPSLIDESLPVGRDENFLIRHLPLYPTYDNASPTARAAYLNWLSGGRRNPGA
DIGYVYLFFYGLERRATVDARTDPAARDEIPAICAEIDGLIKTYRNASFTHRARALLDFC
RYVYGGGQLAPRSLLLDGNSQAKEALLRHALSHAFHERHELPAEWLTAWYLNDSRFLKPT
AAKRHQEMFTAIFADLCHRQFRINLATWAPPLSTKSLQLSYQPVSMALGAVHEALPLPDV
TSDEAGLGRIVEAIAISAADELARYSRFVARYSAPADAPIARLTLPCSRWPGPVWERLAL
ILADLSAGVVVTEPTTLSGLLAPLNADQVLERIPASALIAQIETYLGVGVEPDPRHGAIT
PGASTPIVLFRSGDQPLAEAPREKSTDLLPLHTKHHTRCACVVFFSDLIRFGAPNPSAAL
DAANAIIHRWEDLPDEAHVRLQALLVALTAPEAPAFRGKSALKKQTELIDLSDKESLASE
LVEIARAGGAIEQVAMVRQLEKYFAMLGVDSKSLYDLAHASIGSNTPVAHGGTSVNRGAL
DVERIAALRKETAAVDDVLTSIFADPLEQTPRPVDGVATKTPQEMVSTTAGAEVEFSALP
TLDGRHGALLRELIARDTWAVADFAAACAAHGVMTAGAVERINDAAFEAFDEPHRGYPVM
STSYKSLLAQREALEKQIQEARDLERGQAVENIQEMMRIYDISVAELTGKKTRKYTKRPV
PPKYRDPSSGKTWTGRGKPPVWIAGKNRDQRNMYSNASTIAGYLGSRNYELLAELARRSS
VVCFVDYRTGEGEPLRDVARTQCDLHHGREVFLIAARGFGYVHAFGEDEFRKFCVHWNVE
FIEPSSTGAVGQPTEAAGWTGAVKRAYGHLWHAGRNQATGSTSAAARAIREAKTALLSVL
TPEQRADAVASIRGTNDVPASRHQYPPGL
Download sequence
Identical sequences A0A072TFA1
XP_013442032.1.50012 Medtr0353s0010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]