SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr0400s0010.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr0400s0010.1
Domain Number 1 Region: 114-177
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.00000000746
Family Bacterial dinuclear zinc exopeptidases 0.00084
Further Details:      
 
Weak hits

Sequence:  Medtr0400s0010.1
Domain Number - Region: 48-91
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00284
Family Bacterial exopeptidase dimerisation domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr0400s0010.1
Sequence length 177
Comment | M20/M25/M40 family peptidase | HC | scaffold0400:1844-258 | 20130731
Sequence
MENLLKSIESIRRFRASQFDLIKAGLKAEGDVVSINMAFLKAGTPSPTGFVMNLQPSEAE
AGFDIRVPPTADAESLERRIAEEWAPSCRNMSFRLGQFKQKLSVLDASGKPVITKTDSSN
PWWALLENAVQESGGKLGKPEIFPASTDARYFRRVGLPAIGFSPMANTPILLHDHNE
Download sequence
Identical sequences A0A072TEK5
XP_013441954.1.50012 Medtr0400s0010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]