SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr0803s0020.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr0803s0020.1
Domain Number 1 Region: 226-734
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.7e-127
Family Acetyl-CoA synthetase-like 0.00000154
Further Details:      
 
Domain Number 2 Region: 962-1073
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000000000116
Family Tetracyclin repressor-like, C-terminal domain 0.0061
Further Details:      
 
Domain Number 3 Region: 890-967
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000825
Family Tetracyclin repressor-like, N-terminal domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr0803s0020.1
Sequence length 1081
Comment | long-chain-fatty-acid-CoA ligase, putative | LC | scaffold0803:5105-1280 | 20130731
Sequence
FGPAFGNHRLDTTISRCLPMSPRVVVAIGIDHAGPLNRVAAQAANRWNCVDQRQQLRNIV
GVRASQGHGERCAIGVGDDVMLGARSRAIDGVRASFWPALTARTDDESTAAREKSIWSAA
QSLASNSSWRRSQVAPEPKPICVGRLFDRIPVLSTNRMPFNAARFGTGNRPGFFVRHGFG
GGSNGLMSIHNSSSTIGACVPHDPVDQTLEANRSPRNHYMSKRKNVDGHHEGNRLMATEL
LTQAVRANPNGIATIYGKRQRRWSEVGQRVPRMAGALRELGISEGACVAALAFNSDRYIE
LFFSVPWAGGVLTPLNVRWSFAENKYALTSSETKVLFVDDAFVEQAQQLRDENSSLRAVI
YVGDGDTPPGMLSYEQLIDESEPVDDAGRGSEDIYILFYTGGTTAHPKAVVMQHKAVVHA
ATTYLAMLPKVDTMRYLHQLGFFHVGAATPLWYTTLARGTHVVVPKFDPLPSIHAIAEHR
VTTTTLAPTLISMLLARPECKEYDLSSMNCCIYGGSPMPEPLMAKAKDILPDWCFYQIYG
MTEVNGFATMLRWSDHQHIDDKSSRLRSAGQPAIGVQIRVVLPDGSEARVRQNGEIAVRS
NMLMKEYFGNAQATKEALRDGWMFTGDAGYFDEDGYLYVADRVKDMIRTGEENVFSVDVE
RVLFQHAAIKEVAVFGVPDEKWGEAVHAVVVLNDGAHTTSEELIEHCRARIGGYKCPRTI
EFRTEPLPLTPIGKGQPDEFGGYLVGREVATGLDDLAQLRVDTFDRVRNRHDVAGASCSR
AERFERMDVTIQDMGHWGALRVGRLLLYDEPRVHVSRWPPAVHSYRLSSKIWSRNLPMDI
NPDVIATVGMTSVRDAKPAPGTVIMASTIRTVCCTKEETAVRLAGSSGIMTEKAIRRAAV
GLFAEHGFEAASLRMIAEEVGIQASSLYNYITSKEQLLFDLLREPLVALITEFQEQARRM
SSPYQRLKLFVSLYLQAVLEFPREVLIGDREVRHLNRTHYEQLIALRDEYSLILTSILAD
GARAGDLVIDNARVTTFAILAMLSGISVWYQNDGPVDKDEMIHIHTDLVLRMVGLQFTPF
E
Download sequence
Identical sequences A0A072TEU9
Medtr0803s0020.1 XP_013441543.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]