SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr0835s0010.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr0835s0010.1
Domain Number 1 Region: 106-186
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.000000000000301
Family KorB DNA-binding domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr0835s0010.1
Sequence length 678
Comment | curli production assembly/transport component CsgG | LC | scaffold0835:470-2691 | 20130731
Sequence
VPIAYIKELPDFNVRVHDEAYDQHIDFLAESIRLNGFYQDKPLAGYVASVGGKNVIYLTD
GYSRFKGVKRAIERGANITTLPMVFKPASTSLEDLTVALVTSNEGKPLTPFEKGIVCKRL
EGYGMEIDEIASRLKISALYVGQLLRLMGLPGKIRKMVQEGKISAENALAAQKKHGDQAV
TVLETASALAKASGKTRVTGKNLPGAQLDKVVKKQAPAMADTLRSVKADPGYTALAPEIR
EKLESLLTAIDAAKGPSRDDPQDAAEPATTTGEASAASQYRVISCPLLPSPTLLSEGSAG
DFFAVSVQVETWPEPVASLECCQIGSVDRRVPNCSEGVCMSSSTLTPEFDQRCCSLRAAP
DTSDWLKAAIGALICKDPVDAVNDAELLLEQDGGADSASSVAPPNRRNVGMCHHRTRTQT
MRKTLFTLAAVLFVTSLAACSNMQLMGGGKSPDSTAVAGSNAPTADSMHHCSTPLGTLAV
YEDQRSPWYQLLTSQYQLPSTVPVLKLLVQQSNCFVIVDRGNALDTAIGERALGAAGEIR
ATSRIKKGRMVAADYTMTPSITFSSQNAGSLGGVLSMIPVVGNYAAQVAGQINTKSASTT
LTLVDNRSTVQVAAATGSARNMDIGALGSIMSTHTGGTIAGYADTPEGKVIVAAFTDSLN
NLVDSLKQYKTQHVKGGL
Download sequence
Identical sequences A0A072TPP5
Medtr0835s0010.1 XP_013441525.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]