SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g028070.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g028070.1
Domain Number 1 Region: 4-103
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.000000000000154
Family Bacterial dinuclear zinc exopeptidases 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr1g028070.1
Sequence length 127
Comment | IAA-amino acid hydrolase ILR1-like protein | HC | chr1:9418580-9419356 | 20130731
Sequence
MADMRVVMSTCYHILKQHGKYIQGIVVLVFHPADEGGVGAKKILDSRALENVYVIFGLHI
DPELPIGEMEFRSGPIFVESGFFEAKISGKGGHAVSPQHTIDPILATSKVIIWLQQLVSR
ETDPLDT
Download sequence
Identical sequences A0A072VG46
Medtr1g028070.1 XP_013466337.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]