SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g038920.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g038920.1
Domain Number 1 Region: 32-222,355-437
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.01e-57
Family Bacterial dinuclear zinc exopeptidases 0.000000675
Further Details:      
 
Domain Number 2 Region: 217-331
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000538
Family Bacterial exopeptidase dimerisation domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr1g038920.1
Sequence length 449
Comment | N-acyl-L-amino-acid amidohydrolase | HC | chr1:14434763-14439620 | 20130731
Sequence
MMKLNRGSIFLIAFLLSTLTSLQSSSSSSSEESNIISRFQQYLQIKTNHPTPNYTQSSQF
LISLSKSLSLESQTIELVPGKPIIILKWAGTSPELPSIMLYSHTDVVPAEHDKWVHHPFK
AHVDDEGRIYARGSQDMKCVSMQYLEAVRILKSWDFQPKRTVYLVFAPDEEIGGHDGAEK
FSLSKDFQDLNVGIVLDEGLASPDEHYRAFYAERSPWWLVIKAVGAPGHGSKLYDNSAME
NLLKSIESIRRFRASQFDLIKAGLKAEGDVVSINMAFLKAGTPSPTGFVMNLQPSEAEAG
FDIRVPPTADAESLERRIAEEWAPSCRNMSFRFKQKLSVLDASGKPVITKTDSSNPWWAL
LENAVQESGGKLGKPEIFPASTDARYFRRVGLPAIGFSPMANTPILLHDHNEYLHKDEYL
KGIKVYESIIKAYASFDERVKDGTSKDEL
Download sequence
Identical sequences G7IBH6
XP_003589759.2.50012 Medtr1g038920.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]