SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g038920.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g038920.2
Domain Number 1 Region: 32-222,358-440
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.01e-57
Family Bacterial dinuclear zinc exopeptidases 0.000000696
Further Details:      
 
Domain Number 2 Region: 217-325
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000987
Family Bacterial exopeptidase dimerisation domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr1g038920.2
Sequence length 452
Comment | N-acyl-L-amino-acid amidohydrolase | HC | chr1:14434858-14439597 | 20130731
Sequence
mmklnrgsifliafllstltslqssssssseesniisrfqqylqiktnhptpnytqssqf
lislskslslesqtielvpgkpiiilkwagtspelpsimlyshtdvvpaehdkwvhhpfk
ahvddegriyargsqdmkcvsmqyleavrilkswdfqpkrtvylvfapdeeigghdgaek
fslskdfqdlnvgivldeglaspdehyrafyaerspwwlvikavgapghgsklydnsame
nllksiesirrfrasqfdlikaglkaegdvvsinmaflkagtpsptgfvmnlqpseaeag
fdirvpptadaeslerriaeewapscrnmsfrlgqfkqklsvldasgkpvitktdssnpw
wallenavqesggklgkpeifpastdaryfrrvglpaigfspmantpillhdhneylhkd
eylkgikvyesiikayasfdervkdgtskdel
Download sequence
Identical sequences A0A072VH72
Medtr1g038920.2 XP_013466911.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]