SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g102710.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g102710.1
Domain Number 1 Region: 312-557
Classification Level Classification E-value
Superfamily BEACH domain 2.09e-76
Family BEACH domain 0.0000353
Further Details:      
 
Domain Number 2 Region: 1277-1372,1413-1635
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.31e-33
Family WD40-repeat 0.0036
Further Details:      
 
Domain Number 3 Region: 183-267
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.28e-16
Family Protein kinases, catalytic subunit 0.0075
Further Details:      
 
Domain Number 4 Region: 695-792
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000814
Family Protein kinases, catalytic subunit 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr1g102710.1
Sequence length 1637
Comment | Serine/Threonine kinase | HC | chr1:46423862-46415204 | 20130731
Sequence
MKEKSECFECLQLRINSDFSDQLVFNYAISNSPFPFGSSAILHITSSEDGEAPSGQFILQ
YMSSHHNNCFTNYVNQYILDSNENTKSDDLDVSHGGNGFTTCNHSGRFSCSRTISGIAPI
ACVGKSSYSILQQVANDFLSGLTEDHVLKSLDLFVEGKASGRDSTNFLSLIGFPSFEENN
FPGSLRHPNIAPVLAILKTSGYTNMVLPKTQYNLESILHFNPNALKSDWHRRFLIYQLLS
ALLYLHGLGVSHGNICPSNIMLTDSLWSWLRLWNEPVLESKLTLQESESVKSKPAKIGCC
NDGCHSNDLYADLKLSPLIDWHSSFHQWWKGELSNFEYLLILNRLAGRRWGDHTFHPVMP
WVVDFSSKPDDNCDVGWRDLSKSKWRLAKGDEQLDFTYSTSEIPHHVSDECLSELAVCSY
KARRLPLSVLRMAVRSVYEPNEYPSSMQRLYQWTPDECIPEFYCDPQIFSSVHDGMADLA
TPSWAESPEDFIKLHRDALESNRVSFQLHHWIDIIFGYKMSGEAAIVAKNVMLTQSESTM
PRSTGRRQLFMRPHPIRHATAKITRNGSNKYAKVLTQTNEMQRETSLLSETAYLQELEQA
SAFSEHARHLNACYRYPLNQMKRKNISSLGDPTTGTFTKNISDVSFIDKNYRLPNKMNHI
SFLQHMKEEDEGFSGYPDLLLWRQKLSSSRLASEDIARDIFSVGCLLAELHLCRPLFDSI
SLEIYLEDGTLPGFLQELPPHVRILVEACIQKDWMRRPSAKILLDSPYFPKTIKSSYLFL
APLQLVAKDESRLHFAANLAKQGALRQMGTFATEMCATYCLPLIVNVASDTEAEWAYILL
KELMKCLTAQTVKILILPTIQKILQNTGYLHLKVSLLQDSFVREIWNRVGKQAYLETIHP
LVLSNLYISPDKNSAASASVLLIGSSEEIGVPITINQTILPLVHCFGKGLCVDGIDVLVR
IGGIFGESFIVKQMLPLLKNVVRSFIDVSFVNKPDPVQSWSSLALIDCMMTLDGLVAFLT
EEVIVKELLEDISCIHVGVLMQKHMEITVLQVAANTLFGICQRIGADLTALHILPKLKEL
FDELAFSQEISKGSTAVSRNSKVTKLKIGGDFQIESRMDLVLLLYTLFASLLGIEKLRQC
CATWLLLEQLLLRRHNWKWEYAGESSRNSSESNIAKRPAIAQGFTSEYNPAKLLLNGVGW
SIPQSQGSRGAKNLIQRRPFKVHQSLVVMQEGMSNQVNHEPWFWFPSPATNWDGPAFLGR
VGIQKDDLPWKIRASVSYSIRAHHGAVRSLAVHQDESTVYTAGIGQGYKGTVMKWELSRT
NCLSGYYGHEEVVNDICILSSSGRVASCDGTIHIWDSQTGKQISVFAESETESGHPTNHS
ASVPKITSDQANVLNLNTLSNGMLSSAFDSSLYTCMHLLDSAETLVVGTGNGSLRFIDVA
RGQKLHIWRGESNESSFHSLISAVCSSGSSKAQAGGISTSPSLIATGQSSGHCKLFDAKS
GNVVASWRAHDGYVTKLASPEEHLLISSSLDRTLRVWDLRMNLPSQPIIFRGHSDGISSF
SIWGQDVISISRNRIGLLSLSKSAIETDGQHQIIPQKLYVSSDNGMRSLSALSSISILPF
SRLFLIGTEDGYLRICC
Download sequence
Identical sequences A0A072VPP0
Medtr1g102710.1 XP_013469739.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]