SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g073650.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g073650.1
Domain Number 1 Region: 644-944
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-81
Family Protein kinases, catalytic subunit 0.0000845
Further Details:      
 
Domain Number 2 Region: 88-356
Classification Level Classification E-value
Superfamily L domain-like 3.74e-48
Family Internalin LRR domain 0.049
Further Details:      
 
Weak hits

Sequence:  Medtr2g073650.1
Domain Number - Region: 31-71
Classification Level Classification E-value
Superfamily TSP9-like 0.0942
Family TSP9-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr2g073650.1
Sequence length 1010
Comment | LRR receptor-like kinase | HC | chr2:31258536-31250170 | 20130731
Sequence
MNTSSQFLFLSLIIIWFISLTAIIGANTIHPDEKKVLEVIAKSLGKKDWNFDTDPCSNKP
NWATPTPPGHRLQLVVNNVTCNCSVAGDNFCHVVSITLKGQNLPGTLPPELTRLQYLQFI
DLSRNFLNGTIPKEWGSMMNIRNISLPSNRLTGSIPVEIANISTLIQLDLTANQMSENIP
HELGNLSQIRTLKLSSNNFTGELPATLAKLTTLQDFQISDNQLSGKIPDFIQNWTNINTL
IIQGSGLSGPIPSEISLLSNLTDLRISDLNGLEYAPLPQLDNMPSLKNLILRNCNINGKL
NDYLANITTLKHLDLSFNNLSGTIPSTYAEVSGAKFIFLTGNLLTGSVPAWKKNIDVDIS
YNNLSNSQGSQICQSDKLNLFSPSLAHNDIGTVSCLSGCPKPLYSLFINCGGKQAIVNKK
SYDDDSDSSGAAKFHVSPTGNWAFSTTGIFIDGDQLGETYSPPNLNTLTMADTELYMDAR
VSPISLTYYGFCLANGSYTVNLHFAEIMFTEDQTYGSLGRRLFDIYLQGNLVQKDFNIAN
EAGGVGKKVVKLFKDVIVTSNTLEIRLYWAGKGTQSLPNRSVYGPLISAISVESDHPPGT
ISAGAVAGIVVAATIAIILVFVILWWKGCFGKKNSLARELNSLDVQTGIFTLRQIKAATN
NFDISNKIGEGGFGPVYKGSLPNGTLIAVKQLSSKSKQGNREFLNEIGMISALQHPYLVR
LHGCCVEGDQLFLVYEYLENNSLARALFGPEEHQIKLDWSTRKKICVGIARGLAYLHEES
RLKVVHRDIKATNVLLDANLDPKISDFGLAKLDEEENTHISTRIAGTYGYMAPEYAMHGY
LTDKADVYSFGIVALEIVSGKSNTMYRSKEEAFYLLDWAHLLKERGDLMELVDRRLGLDF
NKKEAMVMINVALLCTNLTSNLRPSMSSVVSMLEGNTVVPEFVSDSSEVMDEKKLEAMRQ
YYYQIEENKTSKSQTQTQSLLTDGPWTASSSSAADLYPVRLDSSYWEKRN
Download sequence
Identical sequences A0A072V9T0
Medtr2g073650.1 XP_013464542.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]