SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g097540.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g097540.1
Domain Number 1 Region: 45-231,336-426
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.43e-85
Family Bacterial dinuclear zinc exopeptidases 0.000000122
Further Details:      
 
Domain Number 2 Region: 218-324
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 2.88e-28
Family Bacterial exopeptidase dimerisation domain 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr2g097540.1
Sequence length 443
Comment | IAA-amino acid hydrolase ILR1-like protein | HC | chr2:41654460-41658806 | 20130731
Sequence
MDFFKCVKLFIVIFISFLSATPIFSDSSTSSNAIPNFLELAKEPQVFDWMVDIRRKIHEN
PELGYEEFETSKLIRTKLDELGVTYKHPVAVTGVIGYIGTGLPPFVALRAEMDALLMQEL
VEWEHKSKVPGKMHACGHDAHVAMLLGAAKILKEHEKQLQGTVVLVFQPAEEGGGGAKKI
LDSGALENVSAIFGLHIGPNIPLGEVASRSGPMLAGGGFFKAVIRGKGGHAANPQHAIDP
ILAASNVIVSLQHIVSREADPLDTQVVTVGNIQGGGAFNVIPNFVTIGGTFRAFLRESFT
QLRQRIEQVIIGQAAVHRCNATVSFLEDKISSYPPTINNDSLHDYFQSVAGSLLGVDKVK
GHHLLMGSEDFAFYQEAMPGYVFIVGMEDVSVERLRSWHSPYFKVNEDVLPYGVALHVSL
ATRYLTKLNQEVPTVDGKYHDEL
Download sequence
Identical sequences G7IRW2
XP_003597384.1.50012 Medtr2g097540.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]