SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g100520.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g100520.1
Domain Number 1 Region: 49-235,340-429
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.29e-83
Family Bacterial dinuclear zinc exopeptidases 0.000000146
Further Details:      
 
Domain Number 2 Region: 222-328
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 2.88e-28
Family Bacterial exopeptidase dimerisation domain 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr2g100520.1
Sequence length 447
Comment | IAA-amino acid hydrolase ILR1-like protein | HC | chr2:43213715-43210621 | 20130731
Sequence
maffkcvnmliiififflcatpifsdssstnskdhlaipkllelakepqvfdwmvdirrk
ihenpevgyeefetsklirtkldelgvpykhpvvvtgvigyigtglppfvalraemdall
mqelvewehkskvpgkmhgcghdahvamllgaakilkehekelqgtivlvfqpaeeggag
akkildagalenvsaifglhvgpniplgevasrsgpmlagggffkavirgkgghaanpqh
aidpilaasnvivslqhivsreadpletqvvtvgniqgggavnvipdsvtiggtfraflr
esltqlrhrieqviigqaavhrcnatvsflddkipsvpptinndslhdyfqsvagsllgi
dkvkghhllmgsedfafyqeampgyvfivgmedvsverlrswhspyfkvnedvfpygaal
hislatrylaklnqevpaedgkyhdel
Download sequence
Identical sequences G7IHW7
Medtr2g100520.1 XP_003597645.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]