SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g104100.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g104100.1
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.22e-27
Family N-terminal domain of MutM-like DNA repair proteins 0.0011
Further Details:      
 
Domain Number 2 Region: 146-233
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.45e-26
Family Middle domain of MutM-like DNA repair proteins 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr2g104100.1
Sequence length 396
Comment | formamidopyrimidine-DNA glycosylase | HC | chr2:44854067-44847474 | 20130731
Sequence
MPELPEVEAARRAVEENCIGKKITKCIVADDNKVIDGVSREEFEASVVGKKIVAARRKGK
NMWLQLDSPPFPSFQFGMAGAVYIKGVAVTKYKRSAVNDEDEWPSKYSKFFIQLDDGLEL
SFTDKRRFARVRLLKDPTSVPPISELGPDALFDFMTLDEFTERLHKKKTEIKALLLDQSY
ISGIGNWVADEVLYQARIHPRQIASSLSGESCSTLYKCIKEVVEKAVEVGADSSQYPTNW
IFHSREKKPGKAFVDGKTIEFITAGGRTTAYVPELQKLSGSQVLKETGKLRGKASKKSSV
DDDNNDGADENLESLKSKKGTKAGAKAKKPSKRKKTEESDDDNDGDAGTDNYDDSDQVEK
KKPGSGTNRKQAKGEKQSKKSVQGNQSSRSTRSKAK
Download sequence
Identical sequences G7II90
XP_003597926.2.50012 Medtr2g104100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]